Phosphatidylinositol Glycan Anchor Biosynthesis, Class Z (PIGZ) (N-Term) antibody

Details for Product No. ABIN502056
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GPI-MT-IV, PIG-Z, SMP3, F630022B06Rik, Ncbp2
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Dog (Canine), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
(3), (2), (2)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502056
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PIGZ
Sequence VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILG VQAARPWEFY
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against PIGZ. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PIGZ
Background The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
Molecular Weight 63 kDa
Gene ID 80235
NCBI Accession NM_025163, NP_079439
UniProt Q86VD9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 579 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class Z (PIGZ) (N-Term) antibody WB Suggested Anti-PIGZ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Product cited in: Taron, Colussi, Wiedman et al.: "Human Smp3p adds a fourth mannose to yeast and human glycosylphosphatidylinositol precursors in vivo." in: The Journal of biological chemistry, Vol. 279, Issue 34, pp. 36083-92, 2004 (PubMed).

Validation Images
back to top