Did you know that you can buy products from over 140 different suppliers from us?

THO Complex 3 (THOC3) (Middle Region) antibody

Details for Product No. ABIN502057
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms THO3, hTREX45, AL033344, 2410044K02Rik, zgc:100815, THOC3
Epitope
Middle Region
(8), (7), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(15), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(14), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (7), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502057
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human THOC3
Sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAG TVKLFGLPND
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against THOC3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name THOC3
Background THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.
Molecular Weight 39 kDa
Gene ID 84321
NCBI Accession NM_032361, NP_115737
UniProt Q96J01
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 351 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Masuda, Das, Cheng et al.: "Recruitment of the human TREX complex to mRNA during splicing." in: Genes & development, Vol. 19, Issue 13, pp. 1512-7, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502057
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top