Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502057

THO Complex 3 (THOC3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms THO3, hTREX45, AL033344, 2410044K02Rik, zgc:100815, THOC3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502057
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-THOC3 antibody: synthetic peptide directed towards the middle region of human THOC3
Sequence LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAG TVKLFGLPND
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against THOC3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name THOC3
Background THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.
Molecular Weight 39kDa
Gene ID 84321
NCBI Accession NP_115737, NM_032361
UniProt Q96J01
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-THOC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Masuda, Das, Cheng et al.: "Recruitment of the human TREX complex to mRNA during splicing." in: Genes & development, Vol. 19, Issue 13, pp. 1512-7, 2005 (PubMed).

Alternatives for antigen "THO Complex 3 (THOC3)", type "Antibodies"
Hosts (8), (3)
Reactivities (9), (2), (2), (1), (1), (1), (1)
Applications (11), (3), (2), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon