Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502074

MGC70863 (MGC70863) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC70863, RPL23A_43_1761
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502074
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MGC70863 antibody: synthetic peptide directed towards the N terminal of human MGC70863
Sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPL ATESAVKKIE
Predicted Reactivity Human :100% Greater horseshoe bat :90%,   Senegalese sole :85%,   Channel catfish :85%,   Green puffer :85%,   Zebrafish :85%,   Dog :85%,   Chicken :85%,   Bovine :85%,   Mouse :85%,   Rat :85%,   Zebra finch :85%,   Atlantic salmon :85%,   Fathead minnow :85%,   Nine-banded armadillo :85%,   Sablefish :85%,   Sheep :85%,   African clawed frog :78%,   Western clawed frog :78%,   Rainbow trout :78%,  
Characteristics This is a rabbit polyclonal antibody against MGC70863. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MGC70863
Background The function of this protein remains unknown.
Molecular Weight 14kDa
Gene ID 284942
NCBI Accession NP_976047, NM_203302
UniProt C9J0D6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MGC70863 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "MGC70863 (MGC70863)", type "Antibodies"
Hosts (1)
Applications (1)
Beacon