Did you know that you can buy products from over 140 different suppliers from us?

MGC70863 (MGC70863) (N-Term) antibody

Details for Product No. ABIN502074
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC70863, RPL23A_43_1761
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502074
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MGC70863
Sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPL ATESAVKKIE
Predicted Reactivity Human :100 % Greater horseshoe bat :90 %,   Senegalese sole :80 %,   Channel catfish :80 %,   Green puffer :80 %,   Zebrafish :80 %,   Dog :80 %,   Chicken :80 %,   Bovine :80 %,   Mouse :80 %,   Rat :80 %,   Zebra finch :80 %,   Atlantic salmon :80 %,   Fathead minnow :80 %,   Nine-banded armadillo :80 %,   Sablefish :80 %,   Sheep :80 %,   African clawed frog :70 %,   Western clawed frog :70 %,   Rainbow trout :70 %,  
Characteristics This is a rabbit polyclonal antibody against MGC70863. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MGC70863
Background The function of this protein remains unknown.
Molecular Weight 14 kDa
Gene ID 284942
NCBI Accession NM_203302, NP_976047
UniProt C9J0D6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 121 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top