Did you know that you can buy products from over 140 different suppliers from us?

Fanconi Anemia Group A Protein (FANCA) (N-Term) antibody

Details for Product No. ABIN502156
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FA, FA-H, FA1, FAA, FACA, FAH, FANCH, AW208693
Epitope
N-Term
(21), (13), (7), (7), (6), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(81), (13), (12), (12), (3), (1)
Host
Rabbit
(70), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(56), (39), (21), (20), (15), (10), (6), (4), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502156
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FANCA
Sequence KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVG ILSAGMVASS
Predicted Reactivity Human : 100 %, Dog : 90 %, Mouse : 90 %, Chicken : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against FANCA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FANCA
Background The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Molecular Weight 33 kDa
Gene ID 2175
NCBI Accession NM_001018112, NP_001018122
UniProt Q86U55
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 297 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Haiman, Hsu, de Bakker et al.: "Comprehensive association testing of common genetic variation in DNA repair pathway genes in relationship with breast cancer risk in multiple populations." in: Human molecular genetics, Vol. 17, Issue 6, pp. 825-34, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502156
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top