Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502156

Fanconi Anemia Group A Protein (FANCA) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FA, FA-H, FA1, FAA, FACA, FAH, FANCH, AW208693
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502156
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FANCA antibody: synthetic peptide directed towards the N terminal of human FANCA
Sequence KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVG ILSAGMVASS
Predicted Reactivity Human : 100%, Dog : 91%, Mouse : 91%, Chicken : 90%, Bovine : 83%
Characteristics This is a rabbit polyclonal antibody against FANCA. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FANCA
Background The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Molecular Weight 33kDa
Gene ID 2175
NCBI Accession NP_001018122, NM_001018112
UniProt Q86U55
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FANCA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Haiman, Hsu, de Bakker et al.: "Comprehensive association testing of common genetic variation in DNA repair pathway genes in relationship with breast cancer risk in multiple populations." in: Human molecular genetics, Vol. 17, Issue 6, pp. 825-34, 2008 (PubMed).

Alternatives for antigen "Fanconi Anemia Group A Protein (FANCA)", type "Antibodies"
Hosts (67), (19)
Reactivities (83), (13), (12), (12), (3), (1)
Applications (58), (33), (21), (20), (13), (12), (9), (4), (2), (2), (1)
Conjugates (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Epitopes (20), (14), (7), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon