Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502162

Troponin T2, Cardiac (TNNT2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CMH2, CMPD2, LVNC6, RCM3, TnTC, cTnT, Tnt, Ctt, CTTG, Tnnt3, RATCTTG, tnnt2, CT3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502162
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TNNT2 antibody: synthetic peptide directed towards the N terminal of human TNNT2
Sequence ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNE LQALIEAHFE
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 100%, African clawed frog : 92%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against TNNT2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TNNT2
Background TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined.
Molecular Weight 35kDa
Gene ID 7139
NCBI Accession NP_000355, NM_000364
UniProt A2TDB9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TNNT2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Klaassen, Probst, Oechslin et al.: "Mutations in sarcomere protein genes in left ventricular noncompaction." in: Circulation, Vol. 117, Issue 22, pp. 2893-901, 2008 (PubMed).

Alternatives for antigen "Troponin T2, Cardiac (TNNT2)", type "Antibodies"
Hosts (159), (32), (2), (1)
Reactivities (148), (42), (31), (25), (22), (17), (14), (13), (10), (8), (7), (3), (2), (1), (1), (1), (1)
Applications (159), (95), (35), (28), (12), (9), (7), (4), (3), (3), (3), (2), (2), (2), (2), (1)
Conjugates (3), (2), (2), (1)
Epitopes (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon