Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502257

Angiopoietin-Like 3 (ANGPTL3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANG-5, ANGPT5, ANL3, FHBL2, hypl, fb60e11, fb66h02, wu:fb60e11, wu:fb66h02, zgc:111943, ANGPTL3, LOC100230785
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502257
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ANGPTL3 antibody: synthetic peptide directed towards the N terminal of human ANGPTL3
Sequence IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKN EEVKNMSLEL
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 92%, Horse : 92%, Rat : 92%, Zebrafish : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against ANGPTL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ANGPTL3
Background The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil dom
Molecular Weight 51kDa
Gene ID 27329
NCBI Accession NP_055310, NM_014495
UniProt Q9Y5C1
Research Area Immunology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ANGPTL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kathiresan, Melander, Guiducci et al.: "Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans." in: Nature genetics, Vol. 40, Issue 2, pp. 189-97, 2008 (PubMed).

Alternatives for antigen "Angiopoietin-Like 3 (ANGPTL3)", type "Antibodies"
Hosts (39), (23), (5), (4), (3)
Reactivities (69), (31), (18), (12)
Applications (55), (44), (10), (8), (2), (2), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon