Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502260

Poliovirus Receptor-Related 3 (PVRL3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CD113, CDW113, NECTIN-3, PPR3, PRR3, PVRR3, 2610301B19Rik, 3000002N23Rik, 4921513D19Rik, AA407785, AU016832, AW538082, PVRL3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502260
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3
Sequence SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLI DGGNETVAAI
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against PVRL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PVRL3
Background Nectins (e.g., PVRL1, MIM 600644) are immunoglobulin-like adhesion molecules that interact with afadin (AF6, MIM 159559). Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adher
Molecular Weight 61kDa
Gene ID 25945
NCBI Accession NP_056295, NM_015480
UniProt Q9NQS3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PVRL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fujito, Ikeda, Kakunaga et al.: "Inhibition of cell movement and proliferation by cell-cell contact-induced interaction of Necl-5 with nectin-3." in: The Journal of cell biology, Vol. 171, Issue 1, pp. 165-73, 2005 (PubMed).

Alternatives for antigen "Poliovirus Receptor-Related 3 (PVRL3)", type "Antibodies"
Hosts (40), (9), (6), (1)
Reactivities (44), (36), (17), (12)
Applications (39), (24), (10), (10), (7), (5), (5), (4), (4), (4), (3), (3), (3), (1)
Conjugates (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (4), (4), (4), (2), (2), (2), (1), (1), (1), (1)
Beacon