Did you know that you can buy products from over 140 different suppliers from us?

Poliovirus Receptor-Related 3 (PVRL3) (N-Term) antibody

Details for Product No. ABIN502260
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PVRL3, CD113, CDW113, NECTIN-3, PPR3, PRR3, PVRR3, 2610301B19Rik, 3000002N23Rik, 4921513D19Rik, AA407785, AU016832, AW538082
Epitope
N-Term
(8), (7), (6), (4), (4), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(53), (37), (17), (12)
Host
Rabbit
(51), (8), (6), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(49), (30), (10), (10), (9), (7), (6), (6), (4), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502260
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PVRL3
Sequence SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLI DGGNETVAAI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against PVRL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PVRL3
Background Nectins (e.g., PVRL1, MIM 600644) are immunoglobulin-like adhesion molecules that interact with afadin (AF6, MIM 159559). Afadin is an actin filament-binding protein that connects nectins to the actin cytoskeleton. The nectin-afadin system organizes adher
Molecular Weight 61 kDa
Gene ID 25945
NCBI Accession NM_015480, NP_056295
UniProt Q9NQS3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 549 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poliovirus Receptor-Related 3 (PVRL3) (N-Term) antibody WB Suggested Anti-PVRL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
Background publications Fujito, Ikeda, Kakunaga et al.: "Inhibition of cell movement and proliferation by cell-cell contact-induced interaction of Necl-5 with nectin-3." in: The Journal of cell biology, Vol. 171, Issue 1, pp. 165-73, 2005 (PubMed).

Validation Images
back to top