Did you know that you can buy products from over 140 different suppliers from us?

Pappalysin 2 (PAPPA2) (N-Term) antibody

Details for Product No. ABIN502272
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PLAC3, Pappe, PAPP-A2, PAPP-E, PAPPE, si:dkey-39f8.1
Epitope
N-Term
(10), (1), (1), (1)
Reactivity
Human
(26), (21), (21), (12), (12), (12), (12)
Host
Rabbit
(28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (14), (10), (7), (6), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502272
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PAPPA2
Sequence PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAY LGNQRSKESL
Predicted Reactivity Human : 100 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against PAPPA2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PAPPA2
Background PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
Molecular Weight 92 kDa
Gene ID 60676
NCBI Accession NM_021936, NP_068755
UniProt A9Z1Y8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 827 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pappalysin 2 (PAPPA2) (N-Term) antibody WB Suggested Anti-PAPPA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502272
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top