Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502281

FLJ14213 (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502281
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ14213 antibody: synthetic peptide directed towards the middle region of human FLJ14213
Sequence LNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRH TVANAHSDIQ
Characteristics This is a rabbit polyclonal antibody against FLJ14213. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The function remains unknown.
Molecular Weight 41kDa
Gene ID 79899
NCBI Accession NP_079117, NM_024841
UniProt Q6MZQ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ14213 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pearce, Huang, Boudeau et al.: "Identification of Protor as a novel Rictor-binding component of mTOR complex-2." in: The Biochemical journal, Vol. 405, Issue 3, pp. 513-22, 2007 (PubMed).

Alternatives for antigen "FLJ14213", type "Antibodies"
Hosts (1)
Reactivities (1), (1), (1), (1), (1), (1)
Applications (1)
Epitopes (1)
Beacon