Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502326

Ret Finger Protein-Like 4B (RFPL4B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF211, Gm62, Gm3037, 100040915
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502326
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFPL4B antibody: synthetic peptide directed towards the middle region of human RFPL4B
Sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIH ANTHLERIPA
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against RFPL4B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RFPL4B
Background RFPL4B contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of RFPL4B remains unknown.
Molecular Weight 30kDa
Gene ID 442247
NCBI Accession NP_001013756, NM_001013734
UniProt Q6ZWI9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFPL4B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Ret Finger Protein-Like 4B (RFPL4B)", type "Antibodies"
Hosts (24), (1)
Reactivities (23)
Applications (11), (10), (9), (6), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1), (1)
Beacon