Ret Finger Protein-Like 4B (RFPL4B) (Middle Region) antibody

Details for Product No. ABIN502326
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RNF211, Gm62, Gm3037, 100040915
Epitope
Middle Region
(5), (1), (1)
Reactivity
Human
(24)
Host
Rabbit
(24), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (10), (6), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502326
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RFPL4B
Sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIH ANTHLERIPA
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against RFPL4B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RFPL4B
Background RFPL4B contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of RFPL4B remains unknown.
Molecular Weight 30 kDa
Gene ID 442247
NCBI Accession NM_001013734, NP_001013756
UniProt Q6ZWI9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 263 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ret Finger Protein-Like 4B (RFPL4B) (Middle Region) antibody WB Suggested Anti-RFPL4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (24), (2)
Reactivities (24)
Applications (10), (10), (10), (6), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1), (1)
back to top