Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502379

Polycomb Group Ring Finger 5 (PCGF5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RNF159, AI324127, 0610009F02Rik, 1110054A01Rik, 5830406C17Rik, 5830443C21Rik, 9530023M17Rik, pcgf5, zgc:136815
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502379
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5
Sequence ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKT CIVQHFEDSN
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Goat : 92%
Characteristics This is a rabbit polyclonal antibody against PCGF5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCGF5
Background PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.
Molecular Weight 30kDa
Gene ID 84333
NCBI Accession NP_115749, NM_032373
UniProt Q86SE9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCGF5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Polycomb Group Ring Finger 5 (PCGF5)", type "Antibodies"
Hosts (3), (1)
Reactivities (3)
Applications (4), (3), (1)
Epitopes (1), (1), (1)
Beacon