Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502384

F-Box and WD Repeat Domain Containing 11 (FBXW11) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos, 2310065A07Rik, AA536858, Fbxw1b, HOS
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502384
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11
Sequence EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGT SSVIVSRKRP
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Rabbit : 100%, Bovine : 92%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against FBXW11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FBXW11
Background FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons.
Molecular Weight 61kDa
Gene ID 23291
NCBI Accession NP_387448, NM_033644
UniProt Q9UKB1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FBXW11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "F-Box and WD Repeat Domain Containing 11 (FBXW11)", type "Antibodies"
Hosts (29), (1)
Reactivities (28), (16), (14), (14), (14), (12), (2), (1), (1), (1)
Applications (20), (11), (10), (5), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (1), (1), (1), (1)
Beacon