Did you know that you can buy products from over 140 different suppliers from us?

F-Box and WD Repeat Domain Containing 11 (FBXW11) (N-Term) antibody

Details for Product No. ABIN502384
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos, 2310065A07Rik, AA536858, Fbxw1b, HOS
Epitope
N-Term
(8), (5), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human, Chicken
(35), (16), (14), (14), (14), (12), (2), (1), (1), (1)
Host
Rabbit
(36), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (17), (10), (10), (10), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502384
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FBXW11
Sequence EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGT SSVIVSRKRP
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Bovine : 90 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against FBXW11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FBXW11
Background FBXW11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbws class and, in addition to an F-box, contains multiple WD40 repeats. This gene contains at least 14 exons, and its alternative splicing generates 3 transcript variants diverging at the presence/absence of two alternate exons.
Molecular Weight 61 kDa
Gene ID 23291
NCBI Accession NM_033644, NP_387448
UniProt Q9UKB1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 529 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-F-Box and WD Repeat Domain Containing 11 (FBXW11) (N-Term) antibody WB Suggested Anti-FBXW11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (36), (1)
Reactivities (35), (16), (14), (14), (14), (12), (2), (1), (1), (1)
Applications (26), (17), (10), (10), (10), (5), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (5), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502384
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top