Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502394

HECT Domain Containing 2 (HECTD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW212605, 4921524L07, A630025O09Rik, hmm77879, HECTD2, DKFZp459J1430
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502394
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HECTD2 antibody: synthetic peptide directed towards the middle region of human HECTD2
Sequence ALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLT IKYFWDVVLG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against HECTD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HECTD2
Background HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Molecular Weight 88kDa
Gene ID 143279
NCBI Accession NP_877497, NM_182765
UniProt Q5U5R9
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HECTD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "HECT Domain Containing 2 (HECTD2)", type "Antibodies"
Hosts (13), (5)
Reactivities (15), (1), (1)
Applications (18), (4), (2), (2), (2)
Epitopes (5), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon