Did you know that you can buy products from over 140 different suppliers from us?

HECT Domain Containing 2 (HECTD2) (Middle Region) antibody

Details for Product No. ABIN502394
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW212605, 4921524L07, A630025O09Rik, hmm77879, HECTD2, DKFZp459J1430
Epitope
Middle Region
(10), (7), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(20), (1), (1)
Host
Rabbit
(18), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (9), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502394
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HECTD2
Sequence ALMLLRPEEVEILVCGSPDLDMHALQRSTQYDGYAKTDLT IKYFWDVVLG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against HECTD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HECTD2
Background HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Molecular Weight 88 kDa
Gene ID 143279
NCBI Accession NM_182765, NP_877497
UniProt Q5U5R9
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 776 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-HECT Domain Containing 2 (HECTD2) (Middle Region) antibody WB Suggested Anti-HECTD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502394
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top