Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502403

Glutaryl-CoA Dehydrogenase (GCDH) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCD, ACAD5, 9030411L18, AI266902, D17825, zgc:56505, zgc:77704
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502403
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GCDH antibody: synthetic peptide directed towards the N terminal of human GCDH
Sequence SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSG SDPSSMETRA
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Pig : 85%, African clawed frog : 84%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against GCDH. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GCDH
Background GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits.Alternatively spliced transcript variants encoding different isoforms have been identified.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight 43kDa
Gene ID 2639
NCBI Accession NP_000150, NM_000159
UniProt Q92947
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GCDH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rao, Albro, Dwyer et al.: "Kinetic mechanism of glutaryl-CoA dehydrogenase." in: Biochemistry, Vol. 45, Issue 51, pp. 15853-61, 2007 (PubMed).

Alternatives for antigen "Glutaryl-CoA Dehydrogenase (GCDH)", type "Antibodies"
Hosts (33), (2)
Reactivities (32), (15), (13), (1), (1)
Applications (25), (13), (12), (10), (5), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (2), (2), (1)
Beacon