Glutaryl-CoA Dehydrogenase (GCDH) antibody

Antigen: Glutaryl-CoA Dehydrogenase (GCDH)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502403

Additional Information

Alternative name: GCD / GCDH

Gene ID: GCDH

UniProt: Q92947

Immunogen: The immunogen for anti-GCDH antibody: synthetic peptide directed towards the N terminal of human GCDH

Sequence: SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSG SDPSSMETRA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GCDH antibody concentration is 1 mg/ml.

Description: GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits.Alternatively spliced transcript variants encoding different isoforms have been identified.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45-kD subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.

Characteristics: Antigen Size: 438 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-GCDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-GCDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Rao, Albro, Dwyer et al.: "Kinetic mechanism of glutaryl-CoA dehydrogenase." in: Biochemistry, Vol. 45, Issue 51, pp. 15853-61, 2007 (PubMed).