Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502537

Chromosome 14 Open Reading Frame 180 (C14orf180) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf77, NRAC
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502537
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C14orf180 antibody: synthetic peptide directed towards the middle region of human C14orf180
Sequence PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVL LVLALGLYCG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C14orf180. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C14orf180
Background C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.
Molecular Weight 18kDa
Gene ID 400258
NCBI Accession NP_001008404, NM_001008404
UniProt Q8N912
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C14orf180 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Chromosome 14 Open Reading Frame 180 (C14orf180)", type "Antibodies"
Hosts (8)
Reactivities (5)
Applications (8), (3)
Epitopes (4), (1)
Beacon