Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502572

Dipeptidyl-Peptidase 6 (DPP6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPPX, VF2, DPP VI, dpp6, si:ch211-198f16.1, B930011P16Rik, D5Buc3, D5Buc4, D5Buc5, Dpp-6, Gm1377, In(5)6H-p, Peplb, Rw, dpp9, im:7145318, zgc:152900, dppx
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502572
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPP6 antibody: synthetic peptide directed towards the middle region of human DPP6
Sequence AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSIS LHVIGLNGPT
Predicted Reactivity Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Pig : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against DPP6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DPP6
Background DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 91kDa
Gene ID 1804
NCBI Accession NP_001034439, NM_001039350
UniProt P42658
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPP6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Dipeptidyl-Peptidase 6 (DPP6)", type "Antibodies"
Hosts (27)
Reactivities (25), (18), (18), (18), (17), (1)
Applications (15), (10), (8), (8), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1)
Beacon