Did you know that you can buy products from over 140 different suppliers from us?

Dipeptidyl-Peptidase 6 (DPP6) (Middle Region) antibody

Details for Product No. ABIN502572
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPPX, VF2, DPP VI, dpp6, si:ch211-198f16.1, B930011P16Rik, D5Buc3, D5Buc4, D5Buc5, Dpp-6, Gm1377, In(5)6H-p, Peplb, Rw, dpp9, im:7145318, zgc:152900, dppx
Epitope
Middle Region
(4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(24), (18), (18), (18), (17), (1)
Host
Rabbit
(26)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(14), (8), (7), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502572
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DPP6
Sequence AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSIS LHVIGLNGPT
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Horse : 90 %, Pig : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against DPP6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DPP6
Background DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 91 kDa
Gene ID 1804
NCBI Accession NM_001039350, NP_001034439
UniProt P42658
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 801 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dipeptidyl-Peptidase 6 (DPP6) (Middle Region) antibody WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502572
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top