Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502575

Kringle Containing Transmembrane Protein 1 (KREMEN1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KREMEN, KRM1, si:ct737139.1, si:dkeyp-7c9.1, Krm1, Kremen, AV002070, krm1, kremen, KREMEN1, kremem1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502575
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KREMEN1 antibody: synthetic peptide directed towards the N terminal of human KREMEN1
Sequence LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKY CEIPACQMPG
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against KREMEN1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KREMEN1
Background KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Molecular Weight 50kDa
Gene ID 83999
NCBI Accession NP_001034659, NM_001039570
UniProt C1P671
Research Area Stem Cells, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KREMEN1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mao, Wu, Davidson et al.: "Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling." in: Nature, Vol. 417, Issue 6889, pp. 664-7, 2002 (PubMed).

Alternatives for antigen "Kringle Containing Transmembrane Protein 1 (KREMEN1)", type "Antibodies"
Hosts (23), (3), (2)
Reactivities (22), (9), (6), (1)
Applications (25), (14), (5), (3), (3), (1), (1)
Epitopes (11), (6), (2), (2), (2), (1), (1)
Beacon