Did you know that you can buy products from over 140 different suppliers from us?

Kringle Containing Transmembrane Protein 1 (KREMEN1) (N-Term) antibody

Details for Product No. ABIN502575
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KREMEN, KRM1, si:ct737139.1, si:dkeyp-7c9.1, Krm1, Kremen, AV002070, krm1, kremen, KREMEN1, kremem1
Epitope
N-Term
(19), (12), (6), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human
(35), (7), (5), (1)
Host
Rabbit
(36), (2), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (3), (3)
Application
Western Blotting (WB)
(32), (30), (12), (7), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502575
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KREMEN1
Sequence LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKY CEIPACQMPG
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Horse : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against KREMEN1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KREMEN1
Background KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Molecular Weight 50 kDa
Gene ID 83999
NCBI Accession NM_001039570, NP_001034659
UniProt C1P671
Research Area Stem Cells, Wnt
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 475 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kringle Containing Transmembrane Protein 1 (KREMEN1) (N-Term) antibody WB Suggested Anti-KREMEN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Background publications Mao, Wu, Davidson et al.: "Kremen proteins are Dickkopf receptors that regulate Wnt/beta-catenin signalling." in: Nature, Vol. 417, Issue 6889, pp. 664-7, 2002 (PubMed).

Hosts (36), (2), (2)
Reactivities (35), (7), (5), (1)
Applications (32), (30), (12), (7), (5), (1), (1)
Conjugates (3), (3), (3), (3), (3), (3)
Epitopes (19), (12), (6), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502575
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top