Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502589

Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930403J22Rik, 5730419O14Rik, RGD1560183, wu:fc58d04, si:ch211-168k14.1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502589
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMTC4 antibody: synthetic peptide directed towards the C terminal of human TMTC4
Sequence NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYH GNLAVLYHRW
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Rabbit : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against TMTC4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMTC4
Background It belongs to the TMTC family. Its exact function remains unknown.
Molecular Weight 83kDa
Gene ID 84899
NCBI Accession NP_001073137, NM_001079669
UniProt Q5T4D3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMTC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4)", type "Antibodies"
Hosts (8)
Reactivities (6), (1), (1), (1)
Applications (8), (2), (1), (1)
Epitopes (5), (2), (1), (1)
Beacon