Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4) (C-Term) antibody

Details for Product No. ABIN502589
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms si:ch211-168k14.1, wu:fc58d04, 4930403J22Rik, 5730419O14Rik, RGD1560183
Epitope
C-Term
(8), (7), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
(10), (1), (1), (1)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (6), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502589
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TMTC4
Sequence NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYH GNLAVLYHRW
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Rabbit : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against TMTC4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMTC4
Background It belongs to the TMTC family. Its exact function remains unknown.
Molecular Weight 83 kDa
Gene ID 84899
NCBI Accession NM_001079669, NP_001073137
UniProt Q5T4D3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 741 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4) (C-Term) antibody WB Suggested Anti-TMTC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top