Did you know that you can buy products from over 140 different suppliers from us?

Synaptophysin (SYP) (N-Term) antibody

Details for Product No. ABIN502628
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRXSYP, Syn, p38, AI848995, A230093K24Rik, Syp1, mrxsyp, syp, xsypi, syp-B, xsypii, MGC86267
Epitope
N-Term
(34), (6), (6), (5), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(186), (81), (55), (22), (3), (3), (2), (2), (1), (1)
Host
Rabbit
(124), (117), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(174), (96), (57), (44), (40), (27), (16), (9), (9), (7), (4), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502628
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SYP
Sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFA FATCGSYSGE
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against SYP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SYP
Background Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
Molecular Weight 34 kDa
Gene ID 6855
NCBI Accession NM_003179, NP_003170
UniProt B2R7L6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 313 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Synaptophysin (SYP) (N-Term) antibody WB Suggested Anti-SYP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
anti-Synaptophysin (SYP) (N-Term) antibody (2) anti-Synaptophysin (SYP) (N-Term) antibody (Image 2)
Product cited in: Stenkamp-Strahm, Kappmeyer, Schmalz et al.: "High-fat diet ingestion correlates with neuropathy in the duodenum myenteric plexus of obese mice with symptoms of type 2 diabetes." in: Cell and tissue research, 2013 (PubMed).

Background publications Glantz, Gilmore, Hamer et al.: "Synaptophysin and postsynaptic density protein 95 in the human prefrontal cortex from mid-gestation into early adulthood." in: Neuroscience, Vol. 149, Issue 3, pp. 582-91, 2007 (PubMed).

Hosts (124), (117), (2), (1)
Reactivities (186), (81), (55), (22), (3), (3), (2), (2), (1), (1)
Applications (174), (96), (57), (44), (40), (27), (16), (9), (9), (7), (4), (1), (1)
Conjugates (5), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (34), (6), (6), (5), (4), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502628
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top