Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502628

Synaptophysin (SYP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRXSYP, Syn, p38, AI848995, A230093K24Rik, Syp1, mrxsyp, syp, xsypi, syp-B, xsypii, MGC86267
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN502628
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SYP antibody: synthetic peptide directed towards the N terminal of human SYP
Sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFA FATCGSYSGE
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against SYP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SYP
Background Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
Molecular Weight 34kDa
Gene ID 6855
NCBI Accession NP_003170, NM_003179
UniProt B2R7L6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SYP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Stenkamp-Strahm, Kappmeyer, Schmalz et al.: "High-fat diet ingestion correlates with neuropathy in the duodenum myenteric plexus of obese mice with symptoms of type 2 diabetes." in: Cell and tissue research, 2013 (PubMed).

Background publications Glantz, Gilmore, Hamer et al.: "Synaptophysin and postsynaptic density protein 95 in the human prefrontal cortex from mid-gestation into early adulthood." in: Neuroscience, Vol. 149, Issue 3, pp. 582-91, 2007 (PubMed).

Alternatives for antigen "Synaptophysin (SYP)", type "Antibodies"
Hosts (112), (104), (7)
Reactivities (162), (82), (49), (24), (3), (3), (3), (2), (1), (1)
Applications (149), (101), (49), (36), (29), (27), (20), (14), (11), (9), (7), (4), (1), (1)
Conjugates (4), (3), (1), (1)
Epitopes (35), (6), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon