Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502713

Lamin B1 (LMNB1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADLD, LMN, LMN2, LMNB, fc06g01, wu:fc06g01, MGC52550, Lamin-L(I), lamin-b, lmn, lmn2, lmnb, LMNB1, LOC100037680
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502713
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LMNB1 antibody: synthetic peptide directed towards the middle region of human LMNB1
Sequence EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTP RASNRSCAIM
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Rabbit : 100%, Rat : 100%, Mouse : 90%, Bovine : 85%, Horse : 85%
Characteristics This is a rabbit polyclonal antibody against LMNB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LMNB1
Background LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1.
Molecular Weight 66kDa
Gene ID 4001
NCBI Accession NP_005564, NM_005573
UniProt P20700
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LMNB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lee, Seng, Sekine et al.: "Vascular endothelial growth factor mediates intracrine survival in human breast carcinoma cells through internally expressed VEGFR1/FLT1." in: PLoS medicine, Vol. 4, Issue 6, pp. e186, 2007 (PubMed).

Alternatives for antigen "Lamin B1 (LMNB1)", type "Antibodies"
Hosts (42), (26), (2)
Reactivities (59), (27), (23), (7), (6), (6), (5), (3), (2), (1), (1), (1), (1)
Applications (69), (35), (20), (19), (15), (11), (11), (10), (4), (2), (1)
Epitopes (13), (4), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Beacon