Lamin B1 (LMNB1) (Middle Region) antibody

Details for Product No. ABIN502713
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ADLD, LMN, LMN2, LMNB, fc06g01, wu:fc06g01, MGC52550, Lamin-L(I), lamin-b, lmn, lmn2, lmnb, LMNB1, LOC100037680
Epitope
Middle Region
(11), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(52), (25), (24), (5), (5), (5), (5), (3), (1)
Host
Rabbit
(37), (18), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(57), (29), (22), (15), (12), (12), (9), (7), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502713
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LMNB1
Sequence EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTP RASNRSCAIM
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Rat : 100 %, Mouse : 90 %, Bovine : 80 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against LMNB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LMNB1
Background LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1.
Molecular Weight 66 kDa
Gene ID 4001
NCBI Accession NM_005573, NP_005564
UniProt P20700
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 586 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lamin B1 (LMNB1) (Middle Region) antibody WB Suggested Anti-LMNB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SK-MEL-2 cell lysate
Product cited in: Lee, Seng, Sekine et al.: "Vascular endothelial growth factor mediates intracrine survival in human breast carcinoma cells through internally expressed VEGFR1/FLT1." in: PLoS medicine, Vol. 4, Issue 6, pp. e186, 2007 (PubMed).

Hosts (37), (18), (2)
Reactivities (52), (25), (24), (5), (5), (5), (5), (3), (1)
Applications (57), (29), (22), (15), (12), (12), (9), (7), (3), (2), (1)
Epitopes (11), (3), (3), (2), (2), (1), (1), (1), (1)
back to top