Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502763

Myelin Protein Zero-Like 2 (MPZL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Eva, Eva1, EVA, EVA1, cb837, eva1, mpzl2, wu:fb07b02
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502763
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MPZL2 antibody: synthetic peptide directed towards the N terminal of human MPZL2
Sequence LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQ FVFYYHIDPF
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Dog : 92%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against MPZL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MPZL2
Background Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous
Molecular Weight 22kDa
Gene ID 10205
NCBI Accession NP_005788, NM_005797
UniProt O70255
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MPZL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Myelin Protein Zero-Like 2 (MPZL2)", type "Antibodies"
Hosts (26), (3)
Reactivities (28), (19), (19), (17), (17), (17)
Applications (15), (14), (10), (7), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1), (1)
Beacon