Did you know that you can buy products from over 140 different suppliers from us?

Myelin Protein Zero-Like 2 (MPZL2) (N-Term) antibody

Details for Product No. ABIN502763
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms cb837, eva1, mpzl2, wu:fb07b02, EVA1, EVA, Eva, Eva1
Epitope
N-Term
(7), (6), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(35), (19), (19), (17), (17), (17)
Host
Rabbit
(33), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (15), (14), (9), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502763
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MPZL2
Sequence LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQ FVFYYHIDPF
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Dog : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against MPZL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MPZL2
Background Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous
Molecular Weight 22 kDa
Gene ID 10205
NCBI Accession NM_005797, NP_005788
UniProt O70255
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 215 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Myelin Protein Zero-Like 2 (MPZL2) (N-Term) antibody WB Suggested Anti-MPZL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Validation Images
back to top