Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502789

Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (S. Cerevisiae) (ALG6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDG1C, E230028F23Rik, CG5091, Dalg6, Dmel\\CG5091, alg6, zgc:100813
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502789
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6
Sequence PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMR TTVLIADLLI
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, Dog : 92%, Horse : 92%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against ALG6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALG6
Background ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic.
Molecular Weight 58kDa
Gene ID 29929
NCBI Accession NP_037471, NM_013339
UniProt Q9Y672
Research Area Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALG6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (S. Cerevisiae) (ALG6)", type "Antibodies"
Hosts (8), (3)
Reactivities (9), (4), (4), (2), (2), (2), (1), (1)
Applications (11), (7), (1)
Epitopes (4), (2)
Beacon