Did you know that you can buy products from over 140 different suppliers from us?

Asparagine-Linked Glycosylation 6, alpha-1,3-Glucosyltransferase Homolog (S. Cerevisiae) (ALG6) (N-Term) antibody

Details for Product No. ABIN502789
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDG1C, E230028F23Rik, CG5091, Dalg6, Dmel\\CG5091, alg6, zgc:100813
Epitope
N-Term
(4), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Zebrafish (Danio rerio), Human, Chicken
(9), (4), (4), (2), (2), (2), (1), (1)
Host
Rabbit
(8), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502789
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ALG6
Sequence PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMR TTVLIADLLI
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Dog : 90 %, Horse : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against ALG6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALG6
Background ALG6 is a member of the ALG6/ALG8 glucosyltransferase family. It catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene encoding ALG6 are associated with congenital disorders of glycosylation type Ic.This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic.
Molecular Weight 58 kDa
Gene ID 29929
NCBI Accession NM_013339, NP_037471
UniProt Q9Y672
Research Area Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 507 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (8), (3)
Reactivities (9), (4), (4), (2), (2), (2), (1), (1)
Applications (11), (4), (1)
Epitopes (4), (2)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502789
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top