Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502801

Transmembrane 9 Superfamily Protein Member 4 (TM9SF4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AA986553, AU045326, B930079E06, mKIAA0255, dJ836N17.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502801
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TM9SF4 antibody: synthetic peptide directed towards the N terminal of human TM9SF4
Sequence HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAE NLGEVLRGDR
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%, Human : 92%
Characteristics This is a rabbit polyclonal antibody against TM9SF4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TM9SF4
Background The function of this protein remains unknown.
Molecular Weight 72kDa
Gene ID 9777
NCBI Accession NP_055557, NM_014742
UniProt Q92544
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TM9SF4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Transmembrane 9 Superfamily Protein Member 4 (TM9SF4)", type "Antibodies"
Hosts (20)
Reactivities (19), (12), (12), (12), (12), (12)
Applications (10), (9), (5), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3)
Beacon