Did you know that you can buy products from over 140 different suppliers from us?

Inositol Monophosphatase Domain Containing 1 (IMPAD1) (Middle Region) antibody

Details for Product No. ABIN502829
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IMP 3, RGD1306455, gPAPP, 1110001C20Rik, AA408880, AI451589, AL022796, B230207P20, Jaws, GPAPP, IMP-3, IMPA3, impa3
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(17), (13), (12), (12), (12), (12)
Host
Rabbit
(17), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502829
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human IMPAD1
Sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVAL QTFGNQTTII
Predicted Reactivity Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against IMPAD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name IMPAD1
Background The function of this protein remains unknown.
Molecular Weight 39 kDa
Gene ID 54928
NCBI Accession NM_017813, NP_060283
UniProt Q9NX62
Research Area Cancer, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Zhang, Li, Martin et al.: "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." in: Nature biotechnology, Vol. 21, Issue 6, pp. 660-6, 2003 (PubMed).

Hosts (17), (2)
Reactivities (17), (13), (12), (12), (12), (12)
Applications (10), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502829
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top