Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502829

Inositol Monophosphatase Domain Containing 1 (IMPAD1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms IMP 3, RGD1306455, gPAPP, 1110001C20Rik, AA408880, AI451589, AL022796, B230207P20, Jaws, GPAPP, IMP-3, IMPA3, impa3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502829
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IMPAD1 antibody: synthetic peptide directed towards the middle region of human IMPAD1
Sequence TAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVAL QTFGNQTTII
Predicted Reactivity Rabbit : 100%, Rat : 100%, Chicken : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against IMPAD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IMPAD1
Background The function of this protein remains unknown.
Molecular Weight 39kDa
Gene ID 54928
NCBI Accession NP_060283, NM_017813
UniProt Q9NX62
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IMPAD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Li, Martin et al.: "Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry." in: Nature biotechnology, Vol. 21, Issue 6, pp. 660-6, 2003 (PubMed).

Alternatives for antigen "Inositol Monophosphatase Domain Containing 1 (IMPAD1)", type "Antibodies"
Hosts (18), (3)
Reactivities (19), (13), (13), (12), (12), (12)
Applications (12), (10), (7), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon