Did you know that you can buy products from over 140 different suppliers from us?

CREB/ATF BZIP Transcription Factor (CREBZF) (Middle Region) antibody

Details for Product No. ABIN502852
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SMILE, ZF, 1110034C16Rik, 6330417B10Rik, LAZip, LAZipII, Zf, RGD1565584
Epitope
Middle Region
(16), (8), (7), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(40), (22), (6), (2)
Host
Rabbit
(39), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (26), (8), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502852
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CREBZF
Sequence AAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELG KRVQALQEES
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against CREBZF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CREBZF
Background CREBZF strongly activates transcription when bound to HCFC1. CREBZF suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and redu
Molecular Weight 37 kDa
Gene ID 58487
NCBI Accession NM_001039618, NP_001034707
UniProt Q9NS37
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 354 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Misra, Rapin, Akhova et al.: "Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman." in: The Journal of biological chemistry, Vol. 280, Issue 15, pp. 15257-66, 2005 (PubMed).

Hosts (39), (1)
Reactivities (40), (22), (6), (2)
Applications (40), (26), (8), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (16), (8), (7), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502852
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top