Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502853

Empty Spiracles Homeobox 1 (EMX1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1564002, zgc:101821, XEmx1, emx1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502853
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EMX1 antibody: synthetic peptide directed towards the middle region of human EMX1
Sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVG AERKQLAGSL
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 91%, Zebrafish : 90%
Characteristics This is a rabbit polyclonal antibody against EMX1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EMX1
Background EMX1 belongs to the EMX homeobox family.It is transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. The protein may function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
Molecular Weight 31kDa
Gene ID 2016
NCBI Accession NP_004088, NM_004097
UniProt Q04741
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EMX1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Empty Spiracles Homeobox 1 (EMX1)", type "Antibodies"
Hosts (30), (6)
Reactivities (35), (30), (27), (13), (12), (12), (12), (1), (1), (1)
Applications (27), (17), (10), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (6), (3), (3), (2)
Beacon