Empty Spiracles Homeobox 1 (EMX1) (Middle Region) antibody

Details for Product No. ABIN502853
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RGD1564002, zgc:101821, XEmx1, emx1
Epitope
Middle Region
(10), (7), (3), (3), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(38), (32), (29), (13), (12), (12), (12), (1), (1), (1)
Host
Rabbit
(33), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (19), (10), (4), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN502853
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EMX1
Sequence DGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVG AERKQLAGSL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %, African clawed frog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against EMX1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EMX1
Background EMX1 belongs to the EMX homeobox family.It is transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. The protein may function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
Molecular Weight 31 kDa
Gene ID 2016
NCBI Accession NM_004097, NP_004088
UniProt Q04741
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Empty Spiracles Homeobox 1 (EMX1) (Middle Region) antibody WB Suggested Anti-EMX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (33), (6)
Reactivities (38), (32), (29), (13), (12), (12), (12), (1), (1), (1)
Applications (30), (19), (10), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (7), (3), (3), (2)
back to top