Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502864

TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TAF(II)18, TAF2K, TAFII-18, TAFII18, 1810004N01Rik, 2010309N11Rik, AI847295, wu:fc20d03, zgc:103651
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502864
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13
Sequence ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMY GFGDDQNPYT
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 85%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against TAF13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TAF13
Background TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF13 is a small subunit associated with a subset of TFIID complexes. TAF13 interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6.
Molecular Weight 14kDa
Gene ID 6884
NCBI Accession NP_005636, NM_005645
UniProt Q15543
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TAF13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13)", type "Antibodies"
Hosts (8), (7)
Reactivities (15), (4)
Applications (7), (7), (4), (2), (1), (1), (1)
Epitopes (2), (1), (1), (1)
Beacon