TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13) antibody

Antigen: TAF13 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 18kDa (TAF13)

Synonyms: TAF2K, TAFII18, MGC22425, wu:fc20d03, zgc:103651, MGC84874, DKFZp469F0433

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN502864

Additional Information

Alternative name: TAF13

Gene ID: TAF13

UniProt: Q15543

Immunogen: The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13

Sequence: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMY GFGDDQNPYT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TAF13 antibody concentration is 1 mg/ml.

Description: TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF13 is a small subunit associated with a subset of TFIID complexes. TAF13 interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-44 AU280379.1 1-44 45-457 X84003.1 1-413 458-577 AV713996.1 405-524

Characteristics: Antigen Size: 124 amino acids

Molecular Weight: 14kDa

Application Details

Application Notes: WB Suggested Anti-TAF13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TAF13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).