Exportin 5 (XPO5) (N-Term) antibody

Details for Product No. ABIN502873
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
exp5, Exp5, RanBp21, AI648907, AW549301, mKIAA1291, 2410004H11Rik, 2700038C24Rik, CG12234, Dmel\\CG12234, Exp-5, RanBP21, dmExp5, exportin-5, ranbp21, DDBDRAFT_0185980, DDBDRAFT_0237583, DDB_0185980,  ... show more
exp5, Exp5, RanBp21, AI648907, AW549301, mKIAA1291, 2410004H11Rik, 2700038C24Rik, CG12234, Dmel\\CG12234, Exp-5, RanBP21, dmExp5, exportin-5, ranbp21, DDBDRAFT_0185980, DDBDRAFT_0237583, DDB_0185980, DDB_0237583, XPO5 show less
Epitope
N-Term
(3), (3), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(31), (14), (14), (12), (12), (12), (12)
Host
Rabbit
(25), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (9), (5), (4), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN502873
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human XPO5
Sequence LTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANC RVGVAALNTL
Predicted Reactivity Human : 100 %, Bovine : 90 %, Guinea pig : 80 %, Mouse : 80 %, Rat : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against XPO5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name XPO5
Background Exportin-5 belongs to a large family of karyopherins that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.Exportin-5 belongs to a large family of karyopherins (see MIM 602738) that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.
Molecular Weight 136 kDa
Gene ID 57510
NCBI Accession NM_020750, NP_065801
UniProt Q9HAV4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1204 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exportin 5 (XPO5) (N-Term) antibody WB Suggested Anti-XPO5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (25), (7)
Reactivities (31), (14), (14), (12), (12), (12), (12)
Applications (23), (10), (9), (5), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (2), (1), (1), (1)
back to top