Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502886

Formin-Like 2 (FMNL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Man, 5430425K04Rik, FHOD2, FMNL2, fmnl2, si:ch211-279a7.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502886
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FMNL2 antibody: synthetic peptide directed towards the N terminal of human FMNL2
Sequence MGNAGSMDSQQTDFRAHNVPLKLPMPEPGELEERFAIVLN AMNLPPDKAR
Predicted Reactivity Human : 100%, Guinea pig : 92%, Mouse : 92%
Characteristics This is a rabbit polyclonal antibody against FMNL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FMNL2
Background FMNL2 is a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined.
Molecular Weight 124kDa
Gene ID 114793
NCBI Accession NP_443137, NM_052905
UniProt Q96PY5
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FMNL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Formin-Like 2 (FMNL2)", type "Antibodies"
Hosts (11), (2)
Reactivities (12), (6), (6), (5), (4), (2), (1), (1), (1), (1)
Applications (11), (6), (5), (2)
Epitopes (3), (2), (1), (1), (1)
Beacon