Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502893

Xin Actin-Binding Repeat Containing 2 (XIRP2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CMYA3, Xin2, Cmya3, Gm352, AI452089, 2310003D02Rik, 2310008C07Rik, A530024P18Rik, LACS, xirp2, sb:cb1045, wu:fc12g12
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502893
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-XIRP2 antibody: synthetic peptide directed towards the C terminal of human XIRP2
Sequence VEPPPRRPMSQKSEIHRANTSPSPPRSRSEQLVRLKDTTA KLSKGAIPCP
Predicted Reactivity Horse : 100%, Human : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Mouse : 91%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against XIRP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name XIRP2
Background XIRP2 belongs to the Xin family. It contains 28 Xin repeats. XIRP2 protects actin filaments from depolymerization.
Molecular Weight 106kDa
Gene ID 129446
NCBI Accession NP_001073278, NM_001079810
UniProt A4UGR9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-XIRP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Huang, Brand, Mathew et al.: "Myomaxin is a novel transcriptional target of MEF2A that encodes a Xin-related alpha-actinin-interacting protein." in: The Journal of biological chemistry, Vol. 281, Issue 51, pp. 39370-9, 2006 (PubMed).

Alternatives for antigen "Xin Actin-Binding Repeat Containing 2 (XIRP2)", type "Antibodies"
Hosts (4)
Reactivities (4), (2)
Applications (4), (2)
Epitopes (1)
Beacon