Xin Actin-Binding Repeat Containing 2 (XIRP2) antibody

Antigen: Xin Actin-Binding Repeat Containing 2 (XIRP2)

Synonyms: CMYA3, FLJ39111, FLJ40200, MYOMAXIN, DKFZp451G055, DKFZp779G1747, Xin2, Cmya3, Gm352, AI452089, 2310003D02Rik, 2310008C07Rik, A530024P18Rik, LACS, XIN, XIRP2, xirp2, sb:cb1045, wu:fc12g12

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN502893

Additional Information

Alternative name: XIRP2 / Beta-Xin

Gene ID: XIRP2

Immunogen: The immunogen for anti-XIRP2 antibody: synthetic peptide directed towards the C terminal of human XIRP2

Sequence: VEPPPRRPMSQKSEIHRANTSPSPPRSRSEQLVRLKDTTA KLSKGAIPCP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-XIRP2 antibody concentration is 1 mg/ml.

Description: XIRP2 belongs to the Xin family. It contains 28 Xin repeats. XIRP2 protects actin filaments from depolymerization.

Characteristics: Antigen Size: 938 amino acids

Molecular Weight: 106kDa

Application Details

Application Notes: WB Suggested Anti-XIRP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-XIRP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate

Publications

Product: Huang, Brand, Mathew et al.: "Myomaxin is a novel transcriptional target of MEF2A that encodes a Xin-related alpha-actinin-interacting protein." in: The Journal of biological chemistry, Vol. 281, Issue 51, pp. 39370-9, 2006 (PubMed).