Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 169 (ZNF169) (N-Term) antibody

Details for Product No. ABIN502895
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Znf169, ZNF169
Epitope
N-Term
(8), (8), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Human
(20), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(18), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (8), (8), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502895
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF169
Sequence EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQY ALSGHPTQIF
Predicted Reactivity Human, Mouse (Murine)
Characteristics This is a rabbit polyclonal antibody against ZNF169. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF169
Background ZNF169 may be involved in transcriptional regulation.
Molecular Weight 68 kDa
Gene ID 169841
NCBI Accession NM_194320, NP_919301
UniProt Q14929
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 603 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Hosts (18), (3)
Reactivities (20), (1), (1), (1), (1), (1), (1)
Applications (20), (8), (8), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (8), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502895
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top