Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502895

Zinc Finger Protein 169 (ZNF169) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Znf169, ZNF169
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502895
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF169 antibody: synthetic peptide directed towards the N terminal of human ZNF169
Sequence EPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQY ALSGHPTQIF
Characteristics This is a rabbit polyclonal antibody against ZNF169. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF169
Background ZNF169 may be involved in transcriptional regulation.
Molecular Weight 68kDa
Gene ID 169841
NCBI Accession NP_919301, NM_194320
UniProt Q14929
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF169 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tsuritani, Irie, Yamashita et al.: "Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes." in: Genome research, Vol. 17, Issue 7, pp. 1005-14, 2007 (PubMed).

Alternatives for antigen "Zinc Finger Protein 169 (ZNF169)", type "Antibodies"
Hosts (12), (3)
Reactivities (14), (2), (2), (1), (1), (1), (1)
Applications (14), (4), (3), (2), (2), (2), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1), (1)
Beacon