G Protein-Coupled Receptor 27 (GPR27) (Middle Region) antibody

Details for Product No. ABIN502901
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SREB1, Sreb1
Epitope
Middle Region
(9), (5), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(44), (22), (22)
Host
Rabbit
(45), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (18), (13), (10), (9), (6), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502901
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GPR27
Sequence AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLT FAQAGINPVV
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against GPR27. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GPR27
Background GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.
Molecular Weight 40 kDa
Gene ID 2850
NCBI Accession NM_018971, NP_061844
UniProt Q9NS67
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 375 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-G Protein-Coupled Receptor 27 (GPR27) (Middle Region) antibody WB Suggested Anti-GPR27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Matsumoto, Saito, Takasaki et al.: "An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system." in: Biochemical and biophysical research communications, Vol. 272, Issue 2, pp. 576-82, 2000 (PubMed).

Hosts (45), (1)
Reactivities (44), (22), (22)
Applications (22), (18), (13), (10), (9), (6), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (5), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top