Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502901

G Protein-Coupled Receptor 27 (GPR27) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SREB1, Sreb1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502901
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27
Sequence AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLT FAQAGINPVV
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against GPR27. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GPR27
Background GPR27 belongs to the G-protein coupled receptor 1 family. GPR27 is an orphan receptor. It is a possible candidate for amine-like G-protein coupled receptor.
Molecular Weight 40kDa
Gene ID 2850
NCBI Accession NP_061844, NM_018971
UniProt Q9NS67
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GPR27 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsumoto, Saito, Takasaki et al.: "An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system." in: Biochemical and biophysical research communications, Vol. 272, Issue 2, pp. 576-82, 2000 (PubMed).

Alternatives for antigen "G Protein-Coupled Receptor 27 (GPR27)", type "Antibodies"
Hosts (47)
Reactivities (45), (22), (22)
Applications (23), (18), (13), (10), (9), (6), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon