Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502926

Peroxiredoxin 2 (PRDX2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA, TR, TPx, TDX1, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839, nkefb, prx-2, prx2, prxii, tdpx1, tpx1, cb58, prdx1, wu:fq19b09, zgc:92891
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502926
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRDX2 antibody: synthetic peptide directed towards the middle region of human PRDX2
Sequence VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRL SEDYGVLKTD
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Sheep : 100%, Pig : 92%, African clawed frog : 91%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against PRDX2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRDX2
Background PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight 22kDa
Gene ID 7001
NCBI Accession NP_005800, NM_005809
UniProt P35704
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRDX2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fang, Nakamura, Cho et al.: "S-nitrosylation of peroxiredoxin 2 promotes oxidative stress-induced neuronal cell death in Parkinson's disease." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 47, pp. 18742-7, 2007 (PubMed).

Alternatives for antigen "Peroxiredoxin 2 (PRDX2)", type "Antibodies"
Hosts (44), (26), (10), (1)
Reactivities (77), (45), (39), (23), (23), (23), (2)
Applications (53), (41), (19), (12), (11), (9), (7), (6), (4), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (10), (4), (2), (1), (1), (1)
Beacon