Did you know that you can buy products from over 140 different suppliers from us?

Peroxiredoxin 2 (PRDX2) (Middle Region) antibody

Details for Product No. ABIN502926
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA, TR, TPx, TDX1, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839, nkefb, prx-2, prx2, prxii, tdpx1, tpx1, cb58, prdx1, wu:fq19b09, zgc:92891
Epitope
Middle Region
(10), (6), (4), (4), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human
(78), (44), (38), (23), (23), (23), (2)
Host
Rabbit
(50), (23), (9), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(61), (40), (19), (16), (15), (14), (9), (6), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN502926
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PRDX2
Sequence VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRL SEDYGVLKTD
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Sheep : 100 %, Pig : 90 %, African clawed frog : 90 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against PRDX2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRDX2
Background PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight 22 kDa
Gene ID 7001
NCBI Accession NM_005809, NP_005800
UniProt P35704
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 198 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Peroxiredoxin 2 (PRDX2) (Middle Region) antibody WB Suggested Anti-PRDX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
anti-Peroxiredoxin 2 (PRDX2) (Middle Region) antibody (2) anti-Peroxiredoxin 2 (PRDX2) (Middle Region) antibody (Image 2)
Background publications Fang, Nakamura, Cho et al.: "S-nitrosylation of peroxiredoxin 2 promotes oxidative stress-induced neuronal cell death in Parkinson's disease." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 104, Issue 47, pp. 18742-7, 2007 (PubMed).

Hosts (50), (23), (9), (1)
Reactivities (78), (44), (38), (23), (23), (23), (2)
Applications (61), (40), (19), (16), (15), (14), (9), (6), (3), (1)
Conjugates (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Epitopes (10), (6), (4), (4), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top