EF-Hand Calcium Binding Domain 4B (EFCAB4B) (Middle Region) antibody

Details for Product No. ABIN502947
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1073, Gm462, CRACR2A
Epitope
Middle Region
(9), (4), (2), (2), (1), (1)
Reactivity
Human
(20), (9), (1)
Host
Rabbit
(20), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(22), (12), (5), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN502947
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EFCAB4B
Sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLK DTERFQARSQ
Predicted Reactivity Horse : 100 %, Human : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against EFCAB4B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EFCAB4B
Background The function of this protein remains unknown.
Molecular Weight 45 kDa
Gene ID 84766
NCBI Accession NM_032680, NP_116069
UniProt Q9BSW2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 395 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-EF-Hand Calcium Binding Domain 4B (EFCAB4B) (Middle Region) antibody WB Suggested Anti-EFCAB4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Hosts (20), (2)
Reactivities (20), (9), (1)
Applications (22), (12), (5), (3), (2), (2)
Epitopes (9), (4), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top