Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502947

EF-Hand Calcium Binding Domain 4B (EFCAB4B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1073, Gm462, CRACR2A
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502947
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EFCAB4B antibody: synthetic peptide directed towards the middle region of human EFCAB4B
Sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLK DTERFQARSQ
Predicted Reactivity Horse : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against EFCAB4B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EFCAB4B
Background The function of this protein remains unknown.
Molecular Weight 45kDa
Gene ID 84766
NCBI Accession NP_116069, NM_032680
UniProt Q9BSW2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EFCAB4B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "EF-Hand Calcium Binding Domain 4B (EFCAB4B)", type "Antibodies"
Hosts (19), (2)
Reactivities (19), (8), (1)
Applications (21), (13), (4), (3), (2), (2)
Epitopes (8), (5), (2), (2), (1), (1)
Beacon