Did you know that you can buy products from over 140 different suppliers from us?

SET and MYND Domain Containing 2 (SMYD2) (N-Term) antibody

Details for Product No. ABIN502963
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms smyd2, im:7146196, wu:fc02f02, zgc:110553, HSKM-B, KMT3C, ZMYND14, Zmynd14, 4930402C15, 1110020E07Rik, smyd2-a
Epitope
N-Term
(5), (4), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(44), (24), (16), (13), (13), (13), (1), (1)
Host
Rabbit
(39), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(34), (15), (10), (9), (4), (4), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502963
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMYD2
Sequence RLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKK DLIQSDIAAL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Chicken : 90 %, Horse : 90 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against SMYD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SMYD2
Background The specific function of this protein remains unknown.
Molecular Weight 50 kDa
Gene ID 56950
NCBI Accession NM_020197, NP_064582
UniProt Q9NRG4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SET and MYND Domain Containing 2 (SMYD2) (N-Term) antibody WB Suggested Anti-SMYD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
Background publications Abu-Farha, Lambert, Al-Madhoun et al.: "The tale of two domains: proteomics and genomics analysis of SMYD2, a new histone methyltransferase." in: Molecular & cellular proteomics : MCP, Vol. 7, Issue 3, pp. 560-72, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502963
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top