Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502983

PGD Synthetase (PGDS) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 21kDa, L-PGDS, PGD2, PGDS, PGDS2, Ptgs3, PH2DISO
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN502983
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS
Sequence EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKN TDLAGNTEME
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against PGDS. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PGDS
Background PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Molecular Weight 23kDa
Gene ID 27306
NCBI Accession NP_055300, NM_014485
UniProt O60760
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PGDS antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Inoue, Okano, Kado et al.: "First determination of the inhibitor complex structure of human hematopoietic prostaglandin D synthase." in: Journal of biochemistry, Vol. 135, Issue 3, pp. 279-83, 2004 (PubMed).

Alternatives for antigen "PGD Synthetase (PGDS)", type "Antibodies"
Hosts (8), (1)
Reactivities (6), (4), (3), (2), (2), (1)
Applications (8), (2), (2), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon