Did you know that you can buy products from over 140 different suppliers from us?

PGD Synthetase (PGDS) (N-Term) antibody

Details for Product No. ABIN502983
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 21kDa, L-PGDS, PGD2, PGDS, PGDS2, Ptgs3, PH2DISO, LPGDS, PDS
Epitope
N-Term
(4), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(5), (2), (1), (1)
Host
Rabbit
(6), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502983
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PGDS
Sequence EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKN TDLAGNTEME
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against PGDS. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PGDS
Background PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Molecular Weight 23 kDa
Gene ID 27306
NCBI Accession NM_014485, NP_055300
UniProt O60760
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 199 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PGD Synthetase (PGDS) (N-Term) antibody Immunohistochemistry with Lung tissue at an antibody concentration of 5µg/ml using anti-PGDS antibody (ARP48763_P050)
Background publications Inoue, Okano, Kado et al.: "First determination of the inhibitor complex structure of human hematopoietic prostaglandin D synthase." in: Journal of biochemistry, Vol. 135, Issue 3, pp. 279-83, 2004 (PubMed).

Validation Images
back to top