Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18) antibody

Antigen: Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 18 (NUDT18)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502998

Additional Information

Alternative name: NUDT18

Gene ID: NUDT18

UniProt: Q6ZVK8

Immunogen: The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the N terminal of human NUDT18

Sequence: MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRK NVCYVVLAVF

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NUDT18 antibody concentration is 1 mg/ml.

Description: NUDT18 belongs to the Nudix hydrolase family. It contains 1 nudix hydrolase domain. NUDT18 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Characteristics: Antigen Size: 323 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-NUDT18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-NUDT18 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).