Did you know that you can buy products from over 140 different suppliers from us?

ADP-Ribosyltransferase 5 (ART5) (Middle Region) antibody

Details for Product No. ABIN503006
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTC5, Yac-2
Epitope
Middle Region
(7), (7), (4), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(31), (14), (14)
Host
Rabbit
(28), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (13), (10), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503006
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ART5
Sequence VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCS HFNCAYLGGE
Predicted Reactivity Horse : 100 %, Dog : 90 %, Rabbit : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against ART5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ART5
Background The specific function of the protein remains unknown. The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.
Molecular Weight 30 kDa
Gene ID 116969
NCBI Accession NM_053017, NP_443750
UniProt Q96L15
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 291 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ADP-Ribosyltransferase 5 (ART5) (Middle Region) antibody WB Suggested Anti-ART5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: PANC1 cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503006
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top