Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503028

Transmembrane Protein 126B (TMEM126B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110001A23Rik, RGD1308371
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503028
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM126B antibody: synthetic peptide directed towards the N terminal of human TMEM126B
Sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQN IYQMATFGTT
Predicted Reactivity Human : 100%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against TMEM126B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM126B
Background It belongs to the TMEM126 family. The function remains unknown.
Molecular Weight 23kDa
Gene ID 55863
NCBI Accession NP_060950, NM_018480
UniProt Q8IUX1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM126B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hu, Han, Song et al.: "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 17, pp. 9543-8, 2000 (PubMed).

Alternatives for antigen "Transmembrane Protein 126B (TMEM126B)", type "Antibodies"
Hosts (5)
Reactivities (3), (1), (1), (1)
Applications (5), (2)
Epitopes (1), (1), (1)
Beacon