Did you know that you can buy products from over 140 different suppliers from us?

Transmembrane Protein 126B (TMEM126B) (N-Term) antibody

Details for Product No. ABIN503028
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110001A23Rik, RGD1308371
Epitope
N-Term
(2), (1), (1), (1)
Reactivity
Human
(6), (3), (1), (1)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM126B
Sequence AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQN IYQMATFGTT
Predicted Reactivity Human : 100 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM126B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM126B
Background It belongs to the TMEM126 family. The function remains unknown.
Molecular Weight 23 kDa
Gene ID 55863
NCBI Accession NM_018480, NP_060950
UniProt Q8IUX1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 200 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 126B (TMEM126B) (N-Term) antibody WB Suggested Anti-TMEM126B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Hu, Han, Song et al.: "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 17, pp. 9543-8, 2000 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top