Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503062

HERPUD Family Member 2 (HERPUD2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AB041580, 5031400M07Rik, RGD1307343, zgc:56020, zgc:76968
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503062
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HERPUD2 antibody: synthetic peptide directed towards the N terminal of human HERPUD2
Sequence MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTH LSNVYPSKPL
Predicted Reactivity Dog : 100%, Human : 100%, Rat : 100%, Chicken : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against HERPUD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HERPUD2
Background HERPUD2 could be involved in the unfolded protein response (UPR) pathway.
Molecular Weight 45kDa
Gene ID 64224
NCBI Accession NP_071768, NM_022373
UniProt Q9BSE4
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HERPUD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "HERPUD Family Member 2 (HERPUD2)", type "Antibodies"
Hosts (4), (1)
Reactivities (4)
Applications (5), (1), (1)
Epitopes (2), (2), (1)
Beacon