Fibronectin Type III Domain Containing 4 (FNDC4) (Middle Region) antibody

Details for Product No. ABIN503072
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FRCP1, Fnmp1, AB030187, AI838506, AW487863, 2810430J06Rik, 6330410H20Rik, FNDC4
Epitope
Middle Region
(3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(28), (17), (17), (17), (17), (17)
Host
Rabbit
(24), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (14), (10), (5), (5), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503072
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FNDC4
Sequence EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAE DSDYTVQVRS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against FNDC4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FNDC4
Background The function of this protein remains unknown.
Molecular Weight 25 kDa
Gene ID 64838
NCBI Accession NM_022823, NP_073734
UniProt Q9H6D8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 234 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (24), (5)
Reactivities (28), (17), (17), (17), (17), (17)
Applications (15), (14), (10), (5), (5), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1)
back to top