Fibronectin Type III Domain Containing 4 (FNDC4) antibody

Antigen: Fibronectin Type III Domain Containing 4 (FNDC4)

Synonyms: FRCP1, Fnmp1, AB030187, AI838506, AW487863, 2810430J06Rik, 6330410H20Rik, FLJ22362, FNDC4, MGC148929

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN503072

Additional Information

Alternative name: FNDC4

Gene ID: FNDC4

UniProt: Q9H6D8

Immunogen: The immunogen for anti-FNDC4 antibody: synthetic peptide directed towards the middle region of human FNDC4

Sequence: EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAE DSDYTVQVRS

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FNDC4 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 234 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-FNDC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FNDC4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Thymus

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).