Transmembrane Protein 135 (TMEM135) (N-Term) antibody

Details for Product No. ABIN503077
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PMP52, 2810439K08Rik, AW319712, RGD1309948, im:6901522, zgc:162425
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Catalog no. ABIN503077
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TMEM135
Sequence SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTA NGALYMAFFC
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Guinea pig : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM135. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM135
Background The exact function of TMEM135 remains unknown.
Molecular Weight 52 kDa
Gene ID 65084
NCBI Accession NM_022918, NP_075069
UniProt Q86UB9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 458 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Hosts (2), (1)
Reactivities (2)
Applications (3), (1)
Epitopes (1)
back to top