Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503077

Transmembrane Protein 135 (TMEM135) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PMP52, 2810439K08Rik, AW319712, RGD1309948, im:6901522, zgc:162425
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503077
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM135 antibody: synthetic peptide directed towards the N terminal of human TMEM135
Sequence SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTA NGALYMAFFC
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 85%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against TMEM135. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM135
Background The exact function of TMEM135 remains unknown.
Molecular Weight 52kDa
Gene ID 65084
NCBI Accession NP_075069, NM_022918
UniProt Q86UB9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM135 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Transmembrane Protein 135 (TMEM135)", type "Antibodies"
Hosts (3)
Reactivities (2), (1), (1)
Applications (3), (2), (1), (1)
Epitopes (1), (1)
Beacon