Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503195

WD Repeat and FYVE Domain Containing 3 (WDFY3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALFY, ZFYVE25, 2610509D04Rik, AW319683, B930017C24, BWF1, Bchs, D5Ertd66e, Ggtb3, mKIAA0993
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503195
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDFY3 antibody: synthetic peptide directed towards the middle region of human WDFY3
Sequence LEVMVNLLHKYAALLKDPTQALNEQGDSRNNSSVEDQKHL ALLVMETLTV
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Guinea pig : 85%, Pig : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against WDFY3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDFY3
Background WDFY3 is a protein which contains WD repeats and an FYVE domain. WDFY3 might target cytosolic protein aggregates for autophagic degradation.Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.This gene encodes a protein which contains WD repeats and an FYVE domain. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Molecular Weight 90kDa
Gene ID 23001
NCBI Accession NP_848698, NM_178583
UniProt Q8IZQ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDFY3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "WD Repeat and FYVE Domain Containing 3 (WDFY3)", type "Antibodies"
Hosts (19), (1)
Reactivities (20), (15), (15), (13), (13), (12), (1)
Applications (10), (8), (7), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon