Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503217

Integrator Complex Subunit 12 (INTS12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms INT12, PHF22, 1110020M19Rik, 2810027J24Rik, 4930529N21Rik, A230056J18Rik, AI666778, Phf22, GB14117, fi17f05, zgc:86602, wu:fi17f05, NV50096
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503217
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-INTS12 antibody: synthetic peptide directed towards the N terminal of human INTS12
Sequence DESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISS SLPSGNNNGK
Predicted Reactivity Dog : 100%, Human : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against INTS12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name INTS12
Background INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).
Molecular Weight 49kDa
Gene ID 57117
NCBI Accession NP_065128, NM_020395
UniProt Q96CB8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-INTS12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Baillat, Hakimi, Näär et al.: "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II." in: Cell, Vol. 123, Issue 2, pp. 265-76, 2005 (PubMed).

Alternatives for antigen "Integrator Complex Subunit 12 (INTS12)", type "Antibodies"
Hosts (7), (2)
Reactivities (9), (2), (2)
Applications (9), (4), (2), (2)
Epitopes (2), (2), (1)
Beacon