Did you know that you can buy products from over 140 different suppliers from us?

Integrator Complex Subunit 12 (INTS12) (N-Term) antibody

Details for Product No. ABIN503217
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms INT12, PHF22, 1110020M19Rik, 2810027J24Rik, 4930529N21Rik, A230056J18Rik, AI666778, Phf22, GB14117, fi17f05, zgc:86602, wu:fi17f05, NV50096
Epitope
N-Term
(2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(9), (4), (3)
Host
Rabbit
(8), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503217
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human INTS12
Sequence DESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISS SLPSGNNNGK
Predicted Reactivity Dog : 100 %, Human : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against INTS12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name INTS12
Background INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).
Molecular Weight 49 kDa
Gene ID 57117
NCBI Accession NM_020395, NP_065128
UniProt Q96CB8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 462 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Integrator Complex Subunit 12 (INTS12) (N-Term) antibody WB Suggested Anti-INTS12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
Background publications Baillat, Hakimi, Näär et al.: "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II." in: Cell, Vol. 123, Issue 2, pp. 265-76, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503217
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top