Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A) (N-Term) antibody

Details for Product No. ABIN503230
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3, LC3a, 1010001H21Rik, 4922501H04Rik, zgc:77094, MGC69006, map1lc3a, MGC53333, MGC89867, MAP1LC3A
Epitope
N-Term
(22), (16), (7), (6), (6), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(133), (83), (76), (42), (24), (24), (14), (12), (3), (3), (1)
Host
Rabbit
(118), (15), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2)
Application
Western Blotting (WB)
(102), (42), (37), (36), (30), (28), (15), (14), (6), (5), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503230
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MAP1LC3A
Sequence MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIE RYKGEKQLPV
Predicted Reactivity Dog : 100 %, Pig : 100 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against MAP1LC3A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAP1LC3A
Background MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 14 kDa
Gene ID 84557
NCBI Accession NM_181509, NP_852610
UniProt Q9H492-2
Research Area Cancer, Autophagy, Cytoskeleton, Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 125 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A) (N-Term) antibody WB Suggested Anti-MAP1LC3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Product cited in: Taylor, Kirkegaard: "Modification of cellular autophagy protein LC3 by poliovirus." in: Journal of virology, Vol. 81, Issue 22, pp. 12543-53, 2007 (PubMed).

Hosts (118), (15), (4), (1)
Reactivities (133), (83), (76), (42), (24), (24), (14), (12), (3), (3), (1)
Applications (102), (42), (37), (36), (30), (28), (15), (14), (6), (5), (4), (2), (2), (1)
Conjugates (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2)
Epitopes (22), (16), (7), (6), (6), (5), (5), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
back to top