Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503230

Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3, LC3a, 1010001H21Rik, 4922501H04Rik, zgc:77094, MGC69006, map1lc3a, MGC53333, MGC89867, MAP1LC3A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503230
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAP1LC3A antibody: synthetic peptide directed towards the N terminal of human MAP1LC3A
Sequence MKMRFFSSPCGKAAVDPADRCKEVQQIRDQHPSKIPVIIE RYKGEKQLPV
Predicted Reactivity Dog : 100%, Pig : 100%, Chicken : 85%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against MAP1LC3A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAP1LC3A
Background MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. MAP1LC3A is one of the light chain subunits and can associate with either MAP1A or MAP1B.MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 14kDa
Gene ID 84557
NCBI Accession NP_852610, NM_181509
UniProt Q9H492-2
Research Area Cancer, Autophagy, Cytoskeleton, Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAP1LC3A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Taylor, Kirkegaard: "Modification of cellular autophagy protein LC3 by poliovirus." in: Journal of virology, Vol. 81, Issue 22, pp. 12543-53, 2007 (PubMed).

Alternatives for antigen "Microtubule-Associated Protein 1 Light Chain 3 alpha (MAP1LC3A)", type "Antibodies"
Hosts (114), (10), (5), (3)
Reactivities (129), (92), (82), (48), (25), (24), (15), (12), (8), (3), (3), (2), (2), (1), (1), (1)
Applications (97), (43), (33), (31), (31), (30), (15), (14), (6), (5), (3), (2), (2), (1)
Conjugates (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Epitopes (23), (15), (6), (5), (5), (5), (5), (5), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon