Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503262

Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fb38h02, fc05g05, chunp6934, wu:fb38h02, wu:fc05g05, CCT-ETA, TCP-1-ETA, CCTETA, CCTH, NIP7-1, TCP1ETA, Ccth, Cctz, AA408524, AL022769, Cct7, cct-eta, ccth, nip7-1, tcp-1-eta
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503262
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCT7 antibody: synthetic peptide directed towards the middle region of human CCT7
Sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGA YAKALEIIPR
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against CCT7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCT7
Background CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.
Molecular Weight 60kDa
Gene ID 10574
NCBI Accession NP_006420, NM_006429
UniProt Q99832
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCT7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Guo, Han, Adam et al.: "Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress." in: Biochemical and biophysical research communications, Vol. 337, Issue 4, pp. 1308-18, 2005 (PubMed).

Alternatives for antigen "Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7)", type "Antibodies"
Hosts (20), (5), (5)
Reactivities (25), (17), (12), (5), (4), (1)
Applications (29), (14), (4), (3), (2), (2), (1)
Epitopes (7), (2), (2), (2), (2), (2), (2), (1)
Beacon