Did you know that you can buy products from over 140 different suppliers from us?

Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody

Details for Product No. ABIN503262
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cct7, cct-eta, ccth, nip7-1, tcp-1-eta, CCTETA, CCTH, NIP7-1, TCP1ETA, CCT-ETA, TCP-1-ETA, AA408524, AL022769, Ccth, Cctz, chunp6934, fb38h02, fc05g05, wu:fb38h02, wu:fc05g05
Epitope
Middle Region
(10), (8), (7), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human, Chicken
(36), (20), (16), (4), (3), (1)
Host
Rabbit
(32), (5), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (22), (4), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503262
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CCT7
Sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGA YAKALEIIPR
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against CCT7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCT7
Background CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date.
Molecular Weight 60 kDa
Gene ID 10574
NCBI Accession NM_006429, NP_006420
UniProt Q99832
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 543 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody WB Suggested Anti-CCT7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
anti-Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody (2) Sample Type: HEK 293 (10ug)
Primary Dilution:
1:1000
Secondary Antibody:
conjugated goat anti-rabbit
Secondary Dilution:
1:10,000
Image Submitted By:
Amy Gray
Brigham Young University

anti-Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7) (Middle Region) antibody (3) WB Suggested Anti-CCT7
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.2500
Positive Control:.93T cell lysate
CCT7 is supported by BioGPS gene expression data to be expressed in HEK293T
Background publications Guo, Han, Adam et al.: "Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress." in: Biochemical and biophysical research communications, Vol. 337, Issue 4, pp. 1308-18, 2005 (PubMed).

Validation Images
back to top